key: cord-0951913-e82rf7sf
authors: Haddad-Boubaker, Sondes; Othman, Houcemeddine; Touati, Rabeb; Ayouni, Kaouther; Lakhal, Marwa; Ben Mustapha, Imen; Ghedira, Kais; Kharrat, Maher; Triki, Henda
title: In silico comparative study of SARS-CoV-2 proteins and antigenic proteins in BCG, OPV, MMR and other vaccines: evidence of a possible putative protective effect
date: 2021-03-26
journal: BMC Bioinformatics
DOI: 10.1186/s12859-021-04045-3
sha: 6cbbccc62f487d830088460b8fa803c0704e61c0
doc_id: 951913
cord_uid: e82rf7sf

BACKGROUND: Coronavirus Disease 2019 (COVID-19) is a viral pandemic disease that may induce severe pneumonia in humans. In this paper, we investigated the putative implication of 12 vaccines, including BCG, OPV and MMR in the protection against COVID-19. Sequences of the main antigenic proteins in the investigated vaccines and SARS-CoV-2 proteins were compared to identify similar patterns. The immunogenic effect of identified segments was, then, assessed using a combination of structural and antigenicity prediction tools. RESULTS: A total of 14 highly similar segments were identified in the investigated vaccines. Structural and antigenicity prediction analysis showed that, among the identified patterns, three segments in Hepatitis B, Tetanus, and Measles proteins presented antigenic properties that can induce putative protective effect against COVID-19. CONCLUSIONS: Our results suggest a possible protective effect of HBV, Tetanus and Measles vaccines against COVID-19, which may explain the variation of the disease severity among regions. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12859-021-04045-3.

proteins, identity levels varied between 21 and 63% (identity rates of ORF1a and ORF3a proteins respectively with HBsAg-adr protein of Hepatitis B virus and Tetanus Toxin protein) (Additional file 1).

Similar segments with main vaccine antigenic proteins were identified along with structural and non-structural proteins of SARS-CoV-2. The majority were shorter than five consecutive amino-acids for all SARS-CoV-2 proteins (Additional file 2). Nevertheless, a total of twelve patterns of six to eight similar consecutive amino-acids were identified in comparison with the main antigenic proteins of Poliovirus, Measles, Streptococcus pneumoniae, Tetanus, Mumps, Hepatitis B, Hib and BCG vaccines (Table1). Two similar segments were identified through comparison of Poliovirus, Measles, PCV10 and Hib proteins and SARS-CoV-2 structural proteins (S and N) and also nonstructural proteins (ORF 1a, ORF 6 and ORF 8) . In contrast, Tetanus, Mumps, Hepatitis B and BCG antigenic proteins showed no more than one similar segment with SARS-CoV-2 proteins (Table1). Among the described peptides, seven were similar to others in the S protein of SARS-CoV-2 and were identified in the antigenic proteins in poliovirus Sabin 3, S pneumoniae, tetanus, Mumps, Hepatitis B and Hib vaccines. The pattern's length varied between six and seven amino acids. Also, one peptide of eight amino acids (GTSPARMA), detected in the Poliovirus VP1 sequence, matched with the N protein of the SARS-CoV-2. Table 1 Description of similar patterns of more than five amino-acids obtained in vaccine antigenic proteins and SARS-CoV-2 proteins We also identified two discontinuous patterns of 10 amino-acids each, DISGFNS-SVI and MSLSLLDLYL, in the tetanus toxin and the hemagglutinin Measles virus proteins which had 90% and 80% similarity with matching segments, DISGINASVV (1168-1177aa), IELSLIDFYL (2-11aa), in the S and ORF7b proteins of SARS-CoV-2 respectively.

First, we focused on characterizing the immunogenicity of the matching sequences with S and N proteins for their involvement in modulating the immune response of the host [19, 20] .

Regarding the pattern GTAPARIS matching with N protein sequence (GTSPARMA), it did not map to the structure of the N protein from SARS-CoV-2. Moreover, no significant match with CMH-I predicted epitope was distinguished. The prediction of the B-cell epitope using the N protein sequence showed a potential antigenic peptide of 51 amino acids (165-216) that harbors the pattern GTSPARMA identified from our similarity search.

Among the seven patterns identified in the SARS-CoV-2 S protein, four segments (LDPLSE, NSVAYS, NLLLQY, PGTNTSN) from Polio, PCV10, Tetanus and HBV vaccines, respectively, have been mapped on the structure of the spike protein S1 subunit (Fig. 1A) . We were also able to map one other pattern, KNLNE, on the structure of the six-helical bundle fusion core solved independently (S2 subunit) from the rest of the ectodomain. The two other patterns (LGFIAGLI, and DISTEI) were not solved by the electron density map from the Cryo-EM structures. Among the five retained patterns, the segments PGTNTSN and LGFIAGLI showed a putative interaction with one of the Fig. 1 Structural mapping in S protein of the segments that match the antigenic proteins from different pathogens. A The location of the segments on the structure is marked by yellow patches. Different chains are represented in different colors. The S1 and S2 subunits have been solved independently. B B-cell epitope prediction from the sequence of SARS-CoV-2 protein. The sequences identified from the similarity analysis are marked in blue. Segments in which amino acid scores are above 0.5 are putative epitope sites. C Cumulative SASA measures for each of the putative antigenic sites calculated using different probe radii MHC-I receptors predicted by IEDB analysis resource NetMHCpan. Furthermore, the prediction for these two peptides showed a weak peptide score of 0.07 and 0.02, respectively (0 indicates no MHC-I capacity, and 1 indicates a high probability). The segment PGTNTSN, existing in the Hbs Ag of Hepatitis B virus adr strain, is located in a turn region.

On the other hand, the prediction of epitopes for B-cell response using Bepipred 2.0 from the IEDB analysis resource showed the implication of four putative patterns from the total set of the seven segments, namely LDPLSE, NSVAYS, DISTEI and PGTNTSN. These segments match the predicted epitopes LDPL, YTMSLGAENSVAYSNN, NLD-SKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYG-FQPTN and TNTSN (Fig. 1B) . The sequence KNLNES does not fall in a putative B-cell epitope region.

We also calculated the Solvent Accessible Surface Area (SASA) using different probe radii to allow better insight into the possible interaction of antibody Complementarity-Determining Regions (CDRs) to the predicted epitopes ( Fig. 1C ). Our results show that exposure to both water molecules and the antibody paratope is only preserved for the segment "PGTNTSN". Consequently, the SASA values at probe radii of 1.4 Å, 5 Å, and 10 Å are 528.69 Å 2 , 497.6 Å 2 , and 305.38 Å 2 , respectively.

Second, we focused on a list of hits that belonged to the investigated vaccine sequences and that match any of the other proteins of SARS-CoV-2. All the patterns have been explored for their antigenic potential using IEDB Bepipred and IEDB NetMHCpan methods. None of the investigated patterns showed a significant putative B-cell antibody binding property. Discontinuous patterns with more than ten residues were discarded from the analysis as they showed low levels of similarity. Consequently, we have retained two segments from Tetanus toxin protein (DISGFNSSVI) and chain A hemagglutinin protein of the Measles virus (MSLSLLDLYL) that significantly matched SARS-CoV-2 Spike and ORF7b proteins, respectively. The segment DISGINASVV of the S protein ( Fig. 2A) showed a putative interaction with the MHC-I receptor encoded by one of the corresponding HLA alleles. DISGINASVV and corresponding matching segment DIS-GFNSSVI showed high peptide scores of 0.88 and 0.76 for the SARS-CoV-2 S and the tetanus toxin proteins, respectively. The segment DISGINASVV is part of the six-helical bundle fusion core of the spike protein. It belongs to the HR2 domain as a random coil structure [21] . The peptide shows an extended conformation within its native environment stabilized by the residues of a small groove formed between two HR1 parallel helices from different monomers. The SASA value for DISGINASVV peptide is 504.88 Å 2 . In contrast, its matching sequence from Tetanus toxin DISGFNSSVI corresponds to a SASA value of 243.3 Å 2 (Fig. 2B ) and the Bepipred tool shows only a partial implication of the sub-string "DISGI" as an epitope in the context of B-cell response.

Regarding the ORF7b and Measles hemagglutinin proteins, the identified similar segments overlap significantly with regions of putative T-cell antigenicity. The matching segment of the Measles hemagglutinin protein (Fig. 2C ) corresponded to a random coil segment (MSLS) spanned by an alpha helix of six residues (LLDLYL) in the crystal structure of the hemagglutinin [22] . The segment also interacts with a large pocket formed mainly by four strands of a beta-sheet containing many aromatic amino acids. The pocket is similar to the groove of the MHC-I molecule ( Fig. 2C and Additional file 3). Moreover, MSLSLLDLYL corresponds to a SASA measured at 439.19 Å 2 (Fig. 2B ). The NetMHCpan tool predicted an antigenicity score of 0.18 for the MSLSLLDLYL segment using the sequence of ORF7b. We also noticed that the matching segment of the Measles hemagglutinin Protein, i.e. "IELSLIDFYL" is represented by a substring "IELSLIDFY" that shows the highest antigenicity score of 0.59 among all the predicted epitopes.

In this study, we investigated the potential protective effect against COVID-19 induced by regularly used vaccines. In the aim to assess their possible implication of in the immune response against SARS-CoV-2, we used a combination of sequence similarity analysis, structural and antigenicity prediction tools to evaluate main antigenic proteins in twelve commonly used vaccines including BCG, OPV and MMR vaccines.

In our study, we identified of similar patterns and found that most of the detected segments were shorter than five amino acids; therefore, they could not constitute a putative T-cell or B-cell epitopes [23] [24] [25] .

Nevertheless, twelve patterns of six to eight amino-acids were found and further investigated. We think that PGTNTSN is the most putative to bind to endogenous antibodies among the four patterns that have been identified by the B-cell epitope prediction tool. Segments of less than 5 amino acids such as the LDPL, a substring of the LDPLSE, are [22] . The peptide (in yellow) shows putative T-cell immunogenicity with the interaction pocket residues (light purple) rarely responsible for inducing humoral immunity response [25] . Moreover, NSVAYS and DISTEI segments are shorter with 10 and 56 amino acids less than the matching predicted epitopes using the entire sequence of the spike protein from SARS-CoV-2. In such a case, the sequence length would be a constraining factor in reproducing the immunological properties for the studied vaccines. That also applies to GTSPARMA segment which is a substring of 51 amino acid putative epitope from the N protein. On the other hand, the PGTNTSN segment of SARS-CoV-2 matches with the predicted epitope TNTSN which is only shorter by two amino acids, compared to both patterns identified for SARS-CoV-2 and its matching segment on HBs Ag-adr.

The pattern PGTNTSN detected in HBsAg of Hepatitis B virus corresponded to an exposed site in the S protein and showed the highest values of accessible surface area compared to the segments identified in the S1 subunit. Additionally, the accessibility of PGTNTSN to the probing spheres mimicking the CDRs antibodies supports its implication in the B-cell mediated response. Thus, its structural properties were consistent with its putative neutralizing capacity. Naturally, the antibodies would be able to recognize the targeted epitope on the whole assembled structure of the virus, and therefore, the epitope must be accessible at the surface of the spike protein. On the other hand, in their recent attempt to establish the antigenicity map of SARS-CoV-2, Zhang et al. have found that a segment called IDh spanning residues 522-646 induces a positive B-cells reaction in sera of convalescent COVID-19 patients [20] . The pattern PGTNTSN was included in the IDh epitope and we were able to identify strong prediction metrics using the IEDB Bepipred tool. Therefore, the induced immunological reaction by this segment would be a humoral response. Furthermore, our results were in agreement with the work published by Tajiri et al. [26] who showed that two regions of HBsAg (residues 104-123 and 108-123) containing the epitope matching the PGTNTSN segment of SARS-CoV-2, were able to bind with two human monoclonal antibodies. This highlighted the immunogenic capability of these segments. There have been concerns about the antibody-dependent enhancement (ADE) of the SARS-CoV-2 infection due to the possible activation of effector functions [27] . The antibody repertoire is thought to be the main culprit for such an effect [28] . However, its magnitude still unknown and recent evidence suggests a non-significant or unclear contribution in enhancing the infectivity of SARS-CoV-2. For instance, the expression of Fcγ receptors through which the effector functions are triggered seems to be very low in alveolar, bronchial, and nasal-cavity epithelial cells (idem). Moreover, it is difficult to distinguish the contribution of the antibody-dependent enhancement of the infection from a severity due to other factors. Recently, in a detailed review, Arvin et al. have stated that current clinical experience is insufficient to implicate a role for ADE of disease, or immune enhancement by any other mechanism, in the severity of COVID-19 [28] .

The segment PGTNTSN is located away from the RBD interaction site to ACE2, separated by an approximate distance of 75 Å. However, the putative antigen, is very close to the fusion peptide SFIEDLLFNKV (residues 816-826 on the PDB structure 7BYR) located at an approximate distance of 35 Å. Moreover, the same region includes the S21P2 segment that has been identified as the epitope for antibodies targeting protein S and enabling the neutralization of the SARS-CoV-2 pseudovirus infection [28] . Therefore, it would be possible to have the same scenario for the PGTNTSN predicted epitope. Furthermore, the location of the PGTNTSN segment overlaps with a putative interaction surface with TMPRSS2 which would impact the cleavage of S1/S2 and S2 sites required for the priming of the S protein [29, 30] .

On the other hand, and considering the S protein conservation, which is constantly facing a selective pressure from the immune system, several studies demonstrated the existence of highly conserved domains in the S protein such as "SD2.1" (amino acids 589-605) which matches with the 'PGTNTSN' segment (600-606) [31] [32] [33] . Still, only, randomized controlled trials might provide evidence of induced protective effect against COVID-19. In many countries, the HBV vaccine is commonly recommended or mandatory for healthcare and wet lab workers. Therefore, it would be interesting to investigate the prevalence of SARS-CoV-2 and clinical manifestations of COVID-19 among HBV vaccinated health workers.

Interestingly, our analysis showed the presence of two segments of ten amino acids from the Tetanus toxin protein and the chain A of the Measles hemagglutinin protein, similar to others located in the S and ORF7b proteins of SARS-CoV-2. The segment DISGINASVV, matching with the toxin tetanus protein has been previously described to be part of an antigenic peptide in the S protein of SARS-CoV-2 [34] . Trigueiro-Louro et al. performed a structure-based strategy targeting highly conserved regions in the Spike domains and demonstrated that the domain "CD-HR2.1" (amino acids 1112-1232), that matches with the regions DISGINASVV, is a "highly conserved druggable regions" [14] . Regarding the segment matching with the ORF7b protein, which may have an accessory function and whose role is yet to be determined [35] , we could not exclude its possible immunogenic role. On the other hand, we have also recorded a significant global identity level between the Measles fusion and hemagglutinin proteins and SARS-CoV-2 spike, envelope and matrix proteins (45-50%) (suppl mat. 1). Furthermore, another study using other Measles and Rubella sequences, different from Edmonston Measles and Wistar RA 27/3 Rubella vaccine strains, revealed similarity between the N terminal region of SARS-COV-2 Spike protein and the Fusion protein of Measles virus as well as the envelope protein of Rubella virus. Still, no similarity was obtained with the crystal structure [18] . It was previously demonstrated that live attenuated vaccines such as OPV, BCG and MMR could improve the innate immune response to other pathogens [36] . These non-specific effects of live vaccines involved the trained immunity which refers to the memory-like characteristics of innate immune cells [37] . Indeed, following exposure to a primary stimulus like a vaccine or a microbial component, innate immune cells, especially monocytes and NK-cells, undergo epigenetic reprogramming that subsequently regulates cytokine production and cell metabolism and it collectively enhances responsiveness to an unrelated secondary stimulus. In this line, observational studies reported a decrease in hospitalization rate and overall mortality among children immunized with live attenuated vaccines [14] . Furthermore, pediatric populations seem to be less vulnerable to COVID-19, especially in low and middle-income countries [14, 38, 39] . The long-term use of an attenuated vaccine, with high coverage rate, could, partially, explain the low symptomatic infection rate among children. Thus, epidemiological studies targeting a largely vaccinated population can help in assessing the protective effect of the MMR vaccine against COVID-19.

Since December 2019, the novel Coronavirus, SARS-CoV-2, spread all around the word causing a worldwide pandemic, and more than 91 million confirmed cases and a million fatalities.

Using an in silico strategy, this study suggests a possible protective effect of HBV, Tetanus and Measles vaccines against SARS-CoV-2 which should be confirmed by extensive epidemiological studies targeting large populations. This possible crossprotection may explain the variation of the disease severity among countries.

Our study focused on twelve vaccines including live attenuated (BCG, OPV, MMR vaccines) and inactivated ones (Tetanus, Corynebacterium diphtheriae, Bordetella pertussis, Hepatitis B, Hepatitis A, Haemophilus influenzae type B (Hib) and Streptococcus pneumoniae vaccines (PCV10) ( Table 2) .

The full amino-acid sequences of the main antigenic proteins (n = 30) corresponding to the 12 investigated vaccines were obtained from NCBI Genbank database (https:// www. ncbi. nlm. nih. gov). Accession numbers are listed in Table 2 . In addition, the amino-acid sequences of the structural proteins (Spike (S), Envelope (E), Membrane glycoprotein (M), Nucleocapsid (N) and non-structural proteins (ORF1ab, ORF1a, ORF3a, ORF6, ORF7a, ORF7ab, ORF8 and ORF10) of SARS-CoV-2 Wuhan reference strain (NC_045512) were obtained from NCBI.

Identification of similar segments, including identical amino-acids and/or similar amino-acids (with similar biochemical properties), was assessed using Blastp homology search by querying the protein sequences of SARS-CoV-2 over the set of antigenic sequences of the vaccines [50] . Blast 2 sequences tool was used with an Expect threshold (E-value) of 10, in order to see shorter alignments, according to the stochastic model of Karlin and Altschul (1990) [51] . Pairwise alignments obtained from Blastp were explored and analyzed using BioEdit software, version 7.2.5 (http:// www. mybio softw are. com/ bioed it-7-0-9-biolo gical-seque nce-align ment-editor. html).

The structure of the SARS-CoV-2 spike protein was obtained from PDB entries 7BYR [52] and 6LXT [21] corresponding to the structure of S1 and S2 subunits respectively. Both structures showed a respective sequence identity of 99.6 and 100% compared to the reference sequence of the S protein from the Wuhan-Hu-1 isolate of SARS-CoV-2 (accession number YP_009724390.1 for the spike protein). The segments matching one of the sequences of S and N proteins were mapped on the structure. The Solvent Accessible Surface Area (SASA) per residue was calculated using freesasa [52] . The B-cell and T-cell epitope predictions were conducted using IEDB analysis resource Bepipred 2.0 [29] and the IEDB analysis resource NetMHCpan [53] methods by uploading the primary structure of SARS-CoV-2 protein; considering all the possible human HLA alleles for MHC class I. These correspond to HLA genes A, B, C, E, and G and cover 134 alleles from different allele groups. A list of these alleles is provided in Additional file 4. The length of the predicted peptides was set to a default value of 8-11 residues, with respect to the proteasomal processing mechanism [54] . A pattern is retained if it shows a good quality local alignment with no indels and no more than two successive dissimilar residues. The matching pattern of the query has to show significant antigenicity prediction, at least with one of the methods, IEDB Bepipred or IEDB NetMHCpan. A cutoff of peptide score no less than 0.1 was used. At this level, the sensitivity and specificity values would be above 0.9, according to the evaluation 

Therapeutic options for the 2019 novel coronavirus (2019-nCoV)

WHO. WHO Coronavirus Disease (COVID-19) Dashboard 2020

Coronaviridae Study Group of the International Committee on Taxonomy of V. The species Severe acute respiratory syndrome-related coronavirus: classifying 2019-nCoV and naming it SARS-CoV-2

Comparative genomic signature representations of the emerging COVID-19 coronavirus and other coronaviruses: high identity and possible recombination between Bat and Pangolin coronaviruses

A new coronavirus associated with human respiratory disease in China

WHO. Coronavirus disease (COVID-19) weekly epidemiological update 2020

SARS-CoV-2 antibody prevalence in Brazil: results from two successive nationwide serological household surveys. The Lancet Global health

The SARS-CoV-2 Coronavirus and the COVID-19 Outbreak

Pathology and pathogenesis of SARS-CoV-2 associated with fatal coronavirus disease

Lockdown measures in response to COVID-19 in nine sub-Saharan African countries

A SARS-CoV-2 surveillance system in Sub-Saharan Africa: modeling study for persistence and transmission to inform policy

A compendium answering 150 questions on COVID-19 and SARS-CoV-2

Considering BCG vaccination to reduce the impact of COVID-19

BCG-induced trained immunity: can it offer protection against COVID-19?

Would immunization be the same without cross-reactivity? Vaccine

SARS-CoV-2 rates in BCG-vaccinated and unvaccinated young adults

BCG vaccine protection from severe coronavirus disease

Does Early Childhood Vaccination Protect Against COVID-19?

Antigenic and immunogenic characterization of recombinant baculovirusexpressed severe acute respiratory syndrome coronavirus spike protein: implication for vaccine design

Mining of epitopes on spike protein of SARS-CoV-2 from COVID-19 patients

Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion

Crystal structure of measles virus hemagglutinin provides insight into effective vaccines

Effects of substitutions in the binding surface of an antibody on antigen affinity

Amino acid similarity accounts for T cell cross-reactivity and for "holes" in the T cell repertoire

Improved method for linear B-cell epitope prediction using antigen's primary sequence

Analysis of the epitope and neutralizing capacity of human monoclonal antibodies induced by hepatitis B vaccine

Beyond binding: antibody effector functions in infectious diseases

A perspective on potential antibody-dependent enhancement of SARS-CoV-2

Targeting TMPRSS2 in SARS-CoV-2 Infection

Two linear epitopes on the SARS-CoV-2 spike protein that elicit neutralising antibodies in COVID-19 patients

Coding potential and sequence conservation of SARS-CoV-2 and related animal viruses

Unlocking COVID therapeutic targets: a structure-based rationale against SARS-CoV-2, SARS-CoV and MERS-CoV Spike

Structure, function, and antigenicity of the SARS-CoV-2 spike glycoprotein

Identification of immunodominant sites on the spike protein of severe acute respiratory syndrome (SARS) coronavirus: implication for developing SARS diagnostics and vaccines

The ORF7b protein of severe acute respiratory syndrome coronavirus (SARS-CoV) is expressed in virus-infected cells and incorporated into SARS-CoV particles

Non-specific effects of vaccines illustrated through the BCG example: from observations to demonstrations

Defining trained immunity and its role in health and disease

Pediatric COVID-19: Systematic review of the literature

Pediatric COVID-19 disease: a review of the recent literature

Infanrix hexa): a review of its use as primary and booster vaccination

Hepatitis B surface antigen (HBsAg) derived from yeast cells (Hansenula polymorpha) used to establish an influence of antigenic subtype (adw2, adr, ayw3) in measuring the immune response after vaccination

Comparative analysis of the complete nucleotide sequences of measles, mumps, and rubella strain genomes contained in Priorix-Tetra and ProQuad live attenuated combined vaccines

Liposome entrapment and immunogenic studies of a synthetic lipophilic multiple antigenic peptide bearing VP1 and VP3 domains of the hepatitis A virus: a robust method for vaccine design

Identification of an immunodominant antigenic site involving the capsid protein VP3 of hepatitis A virus

Properties of proteins MPB64, MPB70, and MPB80 of Mycobacterium bovis BCG

Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Guerin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains

Heterogenous expression of the related MPB70 and MPB83 proteins distinguish various substrains of Mycobacterium bovis BCG and Mycobacterium tuberculosis H37Rv

• fast, convenient online submission • thorough peer review by experienced researchers in your field • rapid publication on acceptance • support for research data, including large and complex data types • gold Open Access which fosters wider collaboration and increased citations maximum visibility for your research: over 100M website views per year research ? Choose BMC

Pneumococcal polysaccharide protein D-conjugate vaccine (Synflorix; PHiD-CV)

Basic local alignment search tool

Methods for assessing the statistical significance of molecular sequence features by using general scoring schemes

Potent Neutralizing Antibodies against SARS-CoV-2 Identified by High-Throughput Single-Cell Sequencing of Convalescent Patients' B Cells

NetMHCpan-4.1 and NetMHCIIpan-4.0: improved predictions of MHC antigen presentation by concurrent motif deconvolution and integration of MS MHC eluted ligand data

The sizes of peptides generated from protein by mammalian 26 and 20 S proteasomes. Implications for understanding the degradative mechanism and antigen presentation

NetMHCpan-4.0: improved peptide-MHC class I interaction predictions integrating eluted ligand and peptide binding affinity data

Antigenicity and immunogenicity of differentially glycosylated hepatitis C virus E2 envelope proteins expressed in mammalian and insect cells

Crystal structures of two viral peptides in complex with murine MHC class I H-2Kb

This study was funded by the Tunisian ministry of higher education and Scientific Research (Research laboratory: Virus, Vectors and Hosts). It was also partially supported by the European project PHINDaccess: Strengthening Omics data analysis capacities in pathogen-host interaction (Grant Agreement ID: 811034).

by Jutz et al. [55] . For IEDB Bepipred, a putative epitope has to show a score above 0.5 for all its constructing amino acids.The Solvent Accessible Surface Area (SASA) was calculated residue wise. Three probing radii were used including one that mimics the solvent molecules (1.4 Å) and two other (5 and 10 Å) to access the accessibility of the Antibody Complementarity-Determining region (CDR) to the putative B-cell epitope [56] .

The online version contains supplementary material available at https:// doi. org/ 10. 1186/ s12859-021-04045-3.Additional file 1: Global amino-acid identities between structural protein sequences of SARS-CoV-2 and main antigenic proteins of investigated vaccines.Additional file 2: Similar patterns identified between SARS-CoV-2 proteins and antigenic proteins in investigated vaccines.Additional file 3: Structure of MHC class I heavy chain in complex with Vesicular stomatitis virus nucleoprotein (PDB code 2VAA) [57] . The binding groove floor is composed of 5 strands beta-sheet, resembling the stabilizing beta-sheet from of MSLSLLDLYL peptide within the Measles hemagglutinin Protein.

List of the HLA alleles used for the prediction of CMH-I binding using IEDB analysis resource.Authors' contributions SH-B, HO and KG designed the study, SH-B and HO wrote the main text, HO, RT, KA and ML contributed to carry out analysis and to prepare figures, SH-B, IBM, MK and HT validated the study. All authors read and approved the final manuscript.

Sondes Haddad-Boubaker is an assistant professor in Virology from the Faculty of Sciences of Tunis. She is an Assistant Professor in the Laboratory of Clinical Virology, at Pasteur Institute of Tunis, which acts as the WHO Regional Reference Laboratory for Poliomyelitis and Measles in the EMR. She is also a Professor of Clinical Virology and the coordinator of the Microbiology section in the High Institute of Health Techniques in Tunis, Tunisia. Her research interest includes molecular characterization and omics data analysis of Human viruses, especially poliovirus, enteric viruses and SARS-CoV2.Houcemeddine Othman is a bioinformatician at the Sydney Brenner Institute for Molecular Bioscience at the University of the Witwatersrand. His main interests are pharmacogenomics, Molecular modeling, and data science. He is an avid supporter of reproducible research practices and data sharing trying to increase awareness about these issues in bioinformatics and genomics fields. Henda Triki is a Professor in Virology since 2006 at the Faculty of Medicine of Tunis (FMT). She is the head of the Laboratory of Clinical Virology, which acts as the WHO Regional Reference Laboratory for Poliomyelitis and Measles in the EMR region. In 2018, she was assigned as Director of the Clinical Investigation Center entitled: "Transmissible diseases: Natural history and innovative tools for diagnostic, prevention and treatment" in Pasteur Institute of Tunis. Currently, she is a member of the National COVID-19 vaccination comity.

This study was funded by the Tunisian Ministry of Higher Education and Scientific Research (Research laboratory: Virus, Vectors and Hosts; LR20IPT10). It was also partially supported by the European project PHINDaccess: Strengthening Omics data analysis capacities in pathogen-host interaction (Grant Agreement ID: 811034).

All data generated or analyzed as part of this study are included in this published article and its supplementary information files. Accession numbers of sequences used in this study are indicated in Table2, in the Material and Methods section of the article. All data generated are available in a public repository https:// figsh are. com/ artic les/ datas et/ Compa rative_ study_ of_ SARS-CoV-2_ prote ins_ and_ antig enic_ prote ins_ in_ BCG_ OPV_ MMR_ and_ other_ vacci nes_ evide nce_ of_ possi ble_ putat ive_ prote ctive_ effect/ 13220 762

This study did not include Human participants or Patient data. Hence no ethical approval and consent to participate is required.

Not applicable. This study did not include patients.

The authors declare that they have no competing interests.