id	author	title	date	pages	extension	mime	words	sentences	flesch	summary	cache	txt
cord-278169-elhz77ek	Zhou, Dapeng	Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: implications for vaccination and antibody therapeutics	2020-06-10		.txt	text/plain	4216	237	51	In this study, we analyzed recombinant severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike protein secreted from BTI-Tn-5B1–4 insect cells, by trypsin and chymotrypsin digestion followed by mass spectrometry analysis. We further analyzed the surface accessibility of spike proteins according to cryogenic electron microscopy and homolog-modeled structures, and available antibodies that bind to SARS-CoV-1. The receptor-binding domain region of the SARS-CoV-1spike protein is densely covered by glycans except FSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQ, which overlaps with a previously identified "Achilles heel" (i.e., vulnerable spot) for antibody binding (Berry, et al. Intranasal vaccination of recombinant adeno-associated virus encoding receptor-binding domain of severe acute respiratory syndrome coronavirus (SARS-CoV) spike protein induces strong mucosal immune responses and provides long-term protection against SARS-CoV infection Receptor-binding domain of severe acute respiratory syndrome coronavirus spike protein contains multiple conformation-dependent epitopes that induce highly potent neutralizing antibodies Effects of Human Anti-Spike Protein Receptor Binding Domain Antibodies on Severe Acute Respiratory Syndrome Coronavirus Neutralization Escape and Fitness	./cache/cord-278169-elhz77ek.txt	./txt/cord-278169-elhz77ek.txt